Rabbit polyclonal LILRA3 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LILRA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 350-378 amino acids from the C-terminal region of human LILRA3. |
Rabbit Polyclonal Anti-LILRA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LILRA3 antibody is: synthetic peptide directed towards the C-terminal region of Human LILRA3. Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE |
Germany
Japan
United Kingdom
China
