LILRA3 Rabbit Polyclonal Antibody

CAT#: TA338121

Rabbit Polyclonal Anti-LILRA3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LILRA3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LILRA3 antibody is: synthetic peptide directed towards the C-terminal region of Human LILRA3. Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name leukocyte immunoglobulin like receptor A3
Background Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.
Synonyms CD85E; HM31; HM43; ILT-6; ILT6; LIR-4; LIR4
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.