LIMS2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | LIMS2 antibody was raised against synthetic peptide C-RWSNMSDALA from an internal region of human LIMS2 (NP_001129509.2; NP_001154875.1). Percent identity with other species by BLAST analysis: Human (100%), Marmoset (90%), Gorilla (80%), Monkey (80%), Rabbit (80%), Opossum (80%), Turkey (80%), Chicken (80%), Platypus (80%), Nectri (80%). |
Rabbit Polyclonal Anti-LIMS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIMS2 antibody is: synthetic peptide directed towards the N-terminal region of Human LIMS2. Synthetic peptide located within the following region: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR |
LIMS2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LIMS2 |
LIMS2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-341 of human LIMS2 (NP_001154875.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
