Antibodies

Jump to Filters
View as table Download
LRP5L Rabbit Polyclonal Antibody
TA337415

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRP5L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRP5L antibody is: synthetic peptide directed towards the C-terminal region of Human LRP5L. Synthetic peptide located within the following region: AKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRV