LRP5L Rabbit Polyclonal Antibody

CAT#: TA337415

Rabbit Polyclonal Anti-LRP5L Antibody

Product Images

Host: Rabbit; Target Name: LRP5L; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LRP5L antibody is: synthetic peptide directed towards the C-terminal region of Human LRP5L. Synthetic peptide located within the following region: AKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: LDL receptor related protein 5 like
• Database Link:
  NP_872298
  Entrez Gene 91355 Human
  UniProt ID A4QPB2
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp434O0213
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome