Antibodies

Jump to Filters
View as table Download
LRRN4CL (Center) Rabbit Polyclonal Antibody
AP52548PU-N

USD 450.00

2 Weeks

LRRN4CL (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 124-154 amino acids from the Central region of human LRRN4CL
LRRN4CL Rabbit Polyclonal Antibody
TA333320

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRRN4CL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRN4CL Antibody: synthetic peptide directed towards the middle region of human LOC221091. Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA