LRRN4CL Rabbit Polyclonal Antibody

CAT#: TA333320

Rabbit Polyclonal Anti-LRRN4CL Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LRRN4CL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LRRN4CL Antibody: synthetic peptide directed towards the middle region of human LOC221091. Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name LRRN4 C-terminal like
Background The function of this protein remains unknown.
Synonyms MGC61707
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Dog: 79%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.