Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-LTK antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LTK. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-LTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LTK antibody: synthetic peptide directed towards the N terminal of human LTK. Synthetic peptide located within the following region: GGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAP |
LTK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human LTK |
Active filters
Target Symbol
- LTK