LTK Rabbit Polyclonal Antibody

CAT#: TA342899

Rabbit Polyclonal Anti-LTK Antibody

Product Images

WB Suggested Anti-LTK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LTK antibody: synthetic peptide directed towards the N terminal of human LTK. Synthetic peptide located within the following region: GGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: leukocyte receptor tyrosine kinase
• Database Link:
  NP_002335
  Entrez Gene 4058 Human
  UniProt ID P29376
• Background: LTK is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation.
• Synonyms: TYK1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transmembrane