Rabbit Polyclonal Anti-LACC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LACC1 antibody: synthetic peptide directed towards the middle region of human LACC1. Synthetic peptide located within the following region: TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN |
Lacc1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to the C-terminal region of mouse Lacc1 / C13orf31 |
9030625A04Rik Antibody - C-terminal region
| Applications | IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China