C13orf31 (LACC1) Rabbit Polyclonal Antibody

CAT#: TA337852

Rabbit Polyclonal Anti-LACC1 Antibody

Product Images

WB Suggested Anti-LACC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LACC1 antibody: synthetic peptide directed towards the middle region of human LACC1. Synthetic peptide located within the following region: TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: laccase domain containing 1
• Database Link:
  NP_694950
  Entrez Gene 144811 Human
  UniProt ID Q8IV20
• Background: The exact functions of LACC1 remain unknown.
• Synonyms: C13orf31; FAMIN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%