Antibodies

View as table Download

Rabbit Polyclonal Anti-LGALS3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS3BP antibody: synthetic peptide directed towards the middle region of human LGALS3BP. Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS3BP mouse monoclonal antibody, clone OTI3D6 (formerly 3D6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-LGALS3BP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LGALS3BP

LGALS3BP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-221 of human LGALS3BP (NP_005558.1).
Modifications Unmodified

LGALS3BP mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody,clone 6B7, HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

LGALS3BP mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody,clone 3G8, Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

LGALS3BP mouse monoclonal antibody,clone 3G8, HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

LGALS3BP mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI5E3 (formerly 5E3), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

LGALS3BP mouse monoclonal antibody, clone OTI5E3 (formerly 5E3), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

LGALS3BP mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI3D6 (formerly 3D6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS3BP mouse monoclonal antibody, clone OTI3D6 (formerly 3D6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

LGALS3BP mouse monoclonal antibody, clone OTI3D6 (formerly 3D6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

LGALS3BP mouse monoclonal antibody, clone OTI3D6 (formerly 3D6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated