Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LHX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LHX4 antibody: synthetic peptide directed towards the middle region of human LHX4. Synthetic peptide located within the following region: GSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSN |
LHX4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 121-390 of human LHX4 (NP_203129.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Active filters
Target Symbol
- LHX4