Antibodies

View as table Download

LMAN2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 284-314 amino acids from the C-terminal region of Human LMAN2

Rabbit Polyclonal Anti-LMAN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2. Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF

Rabbit Polyclonal Anti-LMAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the C terminal of human LMAN2. Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Rabbit Polyclonal Anti-LMAN2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Lman2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Lman2. Synthetic peptide located within the following region: QGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEM

LMAN2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human LMAN2 (NP_006807.1).
Modifications Unmodified