LMAN2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 284-314 amino acids from the C-terminal region of Human LMAN2 |
LMAN2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 284-314 amino acids from the C-terminal region of Human LMAN2 |
Rabbit Polyclonal Anti-LMAN2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2. Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF |
Rabbit Polyclonal Anti-LMAN2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the C terminal of human LMAN2. Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL |
Rabbit Polyclonal Anti-LMAN2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Lman2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Lman2. Synthetic peptide located within the following region: QGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEM |
LMAN2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human LMAN2 (NP_006807.1). |
Modifications | Unmodified |