Antibodies

Jump to Filters
View as table Download
LRRC15 Rabbit Polyclonal Antibody
TA342103

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRRC15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC15 antibody: synthetic peptide directed towards the N terminal of human LRRC15. Synthetic peptide located within the following region: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
LRRC15 Rabbit Polyclonal Antibody
TA369195

USD 380.00

4 Weeks

LRRC15 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LRRC15
LRRC15 Rabbit Monoclonal Antibody [Clone ID: R04-3E9]
TA384678

USD 380.00

4 Weeks

LRRC15 Rabbit monoclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated