LRRC15 Rabbit Polyclonal Antibody

CAT#: TA342103

Rabbit Polyclonal Anti-LRRC15 Antibody

Product Images

WB Suggested Anti-LRRC15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: LRRC15; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; LRRC15 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRC15 antibody: synthetic peptide directed towards the N terminal of human LRRC15. Synthetic peptide located within the following region: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: leucine rich repeat containing 15
• Database Link:
  NP_570843
  Entrez Gene 131578 Human
  UniProt ID Q8TF66
• Background: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) inThe tumor DSRCT and may play a role in cellular invasion.
• Synonyms: LIB
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane