Rabbit Polyclonal Anti-Lsm10 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Lsm10 antibody is: synthetic peptide directed towards the N-terminal region of Rat Lsm10. Synthetic peptide located within the following region: MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFM |
LSM10 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human LSM10 |
LSM10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human LSM10 (NP_116270.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
