Rabbit Polyclonal Anti-MAGEA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9. Synthetic peptide located within the following region: ALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEF |
Rabbit Polyclonal Anti-MAGEA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9. Synthetic peptide located within the following region: QENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPICY |
Rabbit Polyclonal Anti-MAGEA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the N terminal of human MAGEA9. Synthetic peptide located within the following region: RSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEEVSAAGSS |
Carrier-free (BSA/glycerol-free) MAGEA9 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA9 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAGEA9 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAGEA9 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
MAGEA9 mouse monoclonal antibody,clone 1D8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAGEA9 mouse monoclonal antibody,clone 1D8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAGEA9 mouse monoclonal antibody,clone OTI1D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAGEA9 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
MAGEA9 mouse monoclonal antibody,clone 1C6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAGEA9 mouse monoclonal antibody,clone 1C6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAGEA9 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAGEA9 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
MAGEA9 mouse monoclonal antibody,clone 1A11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAGEA9 mouse monoclonal antibody,clone 1A11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAGEA9 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China