MAGEA9 Rabbit Polyclonal Antibody

CAT#: TA343532

Rabbit Polyclonal Anti-MAGEA9 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MAGEA9"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9. Synthetic peptide located within the following region: QENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPICY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name MAGE family member A9
Background MAGEA9 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this g
Synonyms CT1.9; MAGE9
Note Immunogen Sequence Homology: Human: 100%; Dog: 90%; Rat: 90%; Horse: 90%; Rabbit: 90%; Pig: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.