Antibodies

Jump to Filters
View as table Download
MANEA Rabbit Polyclonal Antibody
TA338664

USD 375.00

5 Days

Rabbit Polyclonal Anti-MANEA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MANEA antibody: synthetic peptide directed towards the middle region of human MANEA. Synthetic peptide located within the following region: KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV
MANEA Rabbit Polyclonal Antibody
TA378226

USD 220.00

3 Weeks

MANEA Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human MANEA (NP_078917.2).
Modifications Unmodified