MANEA Rabbit Polyclonal Antibody

CAT#: TA338664

Rabbit Polyclonal Anti-MANEA Antibody

Product Images

Host: Rabbit; Target Name: MANEA; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-MANEA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate MANEA is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MANEA antibody: synthetic peptide directed towards the middle region of human MANEA. Synthetic peptide located within the following region: KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: mannosidase endo-alpha
• Database Link:
  NP_078917
  Entrez Gene 79694 Human
  UniProt ID Q5SRI9
• Background: N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex. This core oligosaccharide is sequentially processed by several ER glycosidases and by an endomannosidase (E.C. 3.2.1.130), such as MANEA, in the Golgi. MANEA catalyzes the release of mono-, di-, and triglucosylmannose oligosaccharides by cleaving the alpha-1,2-mannosidic bond that links them to high-mannose glycans.
• Synonyms: ENDO; hEndo
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 92%; Horse: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane