Germany
Japan
United Kingdom
China
Axotrophin (MARCH7) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 67-95 amino acids from the N-terminal region of Human MARCH7 / RNF177 |
Antibodies
View as table Download
Goat Anti-MARCH7 / Axotrophin Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RTLQAHMEDLETSED, from the internal region of the protein sequence according to NP_073737.1. |
Rabbit Polyclonal Anti-MARCH7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARCH7 antibody: synthetic peptide directed towards the middle region of human MARCH7. Synthetic peptide located within the following region: SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP |
MARCH7 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human MARCH7 |
Active filters
Target Symbol
- MARCH7