Axotrophin (MARCH7) Rabbit Polyclonal Antibody

CAT#: TA330461

Rabbit Polyclonal Anti-MARCH7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MARCH7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MARCH7 antibody: synthetic peptide directed towards the middle region of human MARCH7. Synthetic peptide located within the following region: SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 78 kDa
Gene Name membrane associated ring-CH-type finger 7
Background MARCH7 is an E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Synonyms AXO; AXOT; MARCH-VII; RNF177
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.