Rabbit Polyclonal Anti-MRPS2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS2 antibody: synthetic peptide directed towards the middle region of human MRPS2. Synthetic peptide located within the following region: VHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHS |
Rabbit Polyclonal Anti-MRPS2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS2 antibody: synthetic peptide directed towards the N terminal of human MRPS2. Synthetic peptide located within the following region: MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR |
MRPS2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-296 of human MRPS2 (NP_057118.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
