Antibodies

Jump to Filters
View as table Download
MRPS6 Rabbit Polyclonal Antibody
TA338949

USD 375.00

5 Days

Rabbit Polyclonal Anti-MRPS6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRPS6 antibody: synthetic peptide directed towards the middle region of human MRPS6. Synthetic peptide located within the following region: VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK
MRPS6 Rabbit Polyclonal Antibody
TA378684

USD 220.00

3 Weeks

MRPS6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human MRPS6 (NP_115865.1).
Modifications Unmodified