MRPS6 Rabbit Polyclonal Antibody

CAT#: TA338949

Rabbit Polyclonal Anti-MRPS6 Antibody

Product Images

WB Suggested Anti-MRPS6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRPS6 antibody: synthetic peptide directed towards the middle region of human MRPS6. Synthetic peptide located within the following region: VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: mitochondrial ribosomal protein S6
• Database Link:
  NP_115865
  Entrez Gene 64968 Human
  UniProt ID P82932
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q. [provided by RefSeq, Jul 2008]
• Synonyms: C21orf101; MRP-S6; RPMS6; S6mt
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Rat: 86%; Mouse: 86%; Horse: 85%; Rabbit: 79%; Guinea pig: 77%