Rabbit Polyclonal Anti-MRPS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS7. Synthetic peptide located within the following region: QFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVP |
MRPS7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human MRPS7 |
MRPS7 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human MRPS7 (NP_057055.2). |
MRPS7 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
5 Days
MRPS7 mouse monoclonal antibody, clone OTI5C8 (formerly 5C8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
MRPS7 mouse monoclonal antibody,clone UMAB156
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
MRPS7 mouse monoclonal antibody,clone UMAB156
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Germany
Japan
United Kingdom
China
