MRPS7 Rabbit Polyclonal Antibody

CAT#: TA331933

Rabbit Polyclonal Anti-MRPS7 Antibody

Product Images

Host: Rabbit; Target Name: MRPS7; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; MRPS7 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MRPS7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS7. Synthetic peptide located within the following region: QFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: mitochondrial ribosomal protein S7
• Database Link:
  NP_057055
  Entrez Gene 51081 Human
  UniProt ID Q9Y2R9
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p.
• Synonyms: bMRP27a; MRP-S; MRP-S7; RP-S7; RPMS7; S7mt
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 77%