Antibodies

Jump to Filters
View as table Download
MTCH2 (N-term) Rabbit Polyclonal Antibody
AP23864PU-N

USD 440.00

2 Weeks

MTCH2 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen 15 amino acid peptide near the amino terminus of human MTCH2
MTCH2 Rabbit Polyclonal Antibody
TA306737

USD 430.00

5 Days

Rabbit Polyclonal MTCH2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen MTCH2 antibody was raised against a 15 amino acid peptide near the amino terminus of human MTCH2.
MTCH2 Rabbit Polyclonal Antibody
TA334519

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTCH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTCH2 antibody: synthetic peptide directed towards the N terminal of human MTCH2. Synthetic peptide located within the following region: ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
MTCH2 Rabbit Polyclonal Antibody
TA334520

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTCH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTCH2 antibody: synthetic peptide directed towards the N terminal of human MTCH2. Synthetic peptide located within the following region: TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
MTCH2 Rabbit Polyclonal Antibody
TA350187

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-MTCH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTCH2
MTCH2 Rabbit Polyclonal Antibody
TA378727

USD 220.00

3 Weeks

MTCH2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-175 of human MTCH2 (NP_055157.1).
Modifications Unmodified