Rabbit polyclonal anti-FAM54A antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FAM54A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 282-306 amino acids from the C-terminal region of human FAM54A. |
Rabbit Polyclonal Anti-FAM54A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM54A antibody: synthetic peptide directed towards the middle region of human FAM54A. Synthetic peptide located within the following region: NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ |
Carrier-free (BSA/glycerol-free) FAM54A mouse monoclonal antibody,clone OTI6C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAM54A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
FAM54A mouse monoclonal antibody,clone OTI6C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FAM54A mouse monoclonal antibody,clone OTI6C8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
FAM54A mouse monoclonal antibody,clone OTI6C8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FAM54A mouse monoclonal antibody,clone OTI6C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
