FAM54A (MTFR2) Rabbit Polyclonal Antibody

CAT#: TA339992

Rabbit Polyclonal Anti-FAM54A Antibody

Product Images

WB Suggested Anti-FAM54A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM54A antibody: synthetic peptide directed towards the middle region of human FAM54A. Synthetic peptide located within the following region: NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: mitochondrial fission regulator 2
• Database Link:
  NP_001092756
  Entrez Gene 113115 Human
  UniProt ID Q6P444
• Background: FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.
• Synonyms: DUFD1; FAM54A
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 85%; Rabbit: 83%