Antibodies

Jump to Filters
View as table Download
MUC15 Rabbit Polyclonal Antibody
TA349242

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-MUC15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MUC15
MUC15 (C-term) Rabbit Polyclonal Antibody
AP52773PU-N

USD 450.00

2 Weeks

MUC15 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 208-237aa) of human Mucin-15
MUC15 Rabbit Polyclonal Antibody
TA337897

USD 375.00

5 Days

Rabbit Polyclonal Anti-MUC15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MUC15 antibody: synthetic peptide directed towards the middle region of human MUC15. Synthetic peptide located within the following region: KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
MUC15 Rabbit Polyclonal Antibody
TA368751

USD 380.00

4 Weeks

MUC15 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MUC15