MUC15 Rabbit Polyclonal Antibody

CAT#: TA337897

Rabbit Polyclonal Anti-MUC15 Antibody

Product Images

WB Suggested Anti-MUC15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MUC15 antibody: synthetic peptide directed towards the middle region of human MUC15. Synthetic peptide located within the following region: KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: mucin 15, cell surface associated
• Database Link:
  NP_663625
  Entrez Gene 143662 Human
  UniProt ID Q8N387
• Background: May play a role in the cell adhesion to the extracellular matrix.
• Synonyms: MUC-15; PAS3; PASIII
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Bovine: 90%; Mouse: 85%; Pig: 79%; Horse: 79%; Guinea pig: 79%; Dog: 77%

Reference Data

• Protein Families: Secreted Protein, Transmembrane