Antibodies

View as table Download

Rabbit Polyclonal Anti-MYL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG

Myosin light chain 3 (MYL3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant human myosin (cardiac) light chain fragment.

Rabbit polyclonal anti-MYL3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MYL3.

Rabbit Polyclonal Anti-MYL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3

MYL3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3

MYL3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MYL3 (NP_000249.1).
Modifications Unmodified