Rabbit Polyclonal Anti-MYL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG |
Myosin light chain 3 (MYL3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant human myosin (cardiac) light chain fragment. |
Rabbit polyclonal anti-MYL3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MYL3. |
Rabbit Polyclonal Anti-MYL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYL3 |
MYL3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYL3 |
Germany
Japan
United Kingdom
China
