Antibodies

View as table Download

Rabbit Polyclonal Anti-MACROD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MACROD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human MACROD1. Synthetic peptide located within the following region: MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMA

MACROD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MACROD1

MACROD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MACROD1