MACROD1 Rabbit Polyclonal Antibody

CAT#: TA331983

Rabbit Polyclonal Anti-MACROD1 Antibody

Product Images

Host: Rabbit; Target Name: MACROD1; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MACROD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human MACROD1. Synthetic peptide located within the following region: MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: MACRO domain containing 1
• Database Link:
  NP_054786
  Entrez Gene 28992 Human
  UniProt ID Q9BQ69
• Background: MACROD1 deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. It plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen and may play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. It could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction and could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. MACROD1 enhances ESR1-mediated transcription activity.
• Synonyms: LRP16
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%