Antibodies

View as table Download

MAFK mouse monoclonal antibody, clone AT2F7, Purified

Applications ELISA, WB
Reactivities Human

MAFK mouse monoclonal antibody, clone AT2F7, Purified

Applications ELISA, WB
Reactivities Human

Rabbit Polyclonal Anti-MAFK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFK antibody: synthetic peptide directed towards the N terminal of human MAFK. Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY

Mafk Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated