Rabbit Polyclonal Anti-MAP4K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR |
Rabbit Polyclonal Anti-MAP4K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE |
Rabbit Polyclonal Anti-MAP4K2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAP4K2 |
MAP4K2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAP4K2 |
MAP4K2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 551-820 of human MAP4K2 (NP_004570.2). |
| Modifications | Unmodified |
MAP4K2/3 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human GCK/GLK. at AA range: 221-270 |
Germany
Japan
United Kingdom
China
