Antibodies

View as table Download

Rabbit Polyclonal Anti-MARCO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARCO antibody: synthetic peptide directed towards the N terminal of human MARCO. Synthetic peptide located within the following region: QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL

Rabbit Polyclonal Anti-MARCO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARCO antibody: synthetic peptide directed towards the C terminal of human MARCO. Synthetic peptide located within the following region: GPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGE

MARCO Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse MARCO

MARCO Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1).
Modifications Unmodified

Recombinant Anti-MARCO (Clone PLK1)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-MARCO (Clone PLK1)

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated