Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Matrilin 3 (MATN3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 219-248 amino acids from the Central region of human Matrilin-3 |
Rabbit Polyclonal Anti-MATN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MATN3 antibody: synthetic peptide directed towards the N terminal of human MATN3. Synthetic peptide located within the following region: ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADT |
Rabbit Polyclonal Anti-MATN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MATN3 antibody: synthetic peptide directed towards the middle region of human MATN3. Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA |
MATN3 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
MATN3 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
MATN3 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
MATN3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 277-486 of human MATN3 (NP_002372.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MATN3