Rabbit Polyclonal Anti-MBIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the C-terminal region of Human MBIP. Synthetic peptide located within the following region: FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH |
Rabbit Polyclonal Anti-MBIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the N-terminal region of Human MBIP. Synthetic peptide located within the following region: EVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRI |
MBIP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MBIP |
MBIP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-344 of human MBIP (NP_057670.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China