MAP3K12 binding inhibitory protein 1 (MBIP) Rabbit Polyclonal Antibody

CAT#: TA342912

Rabbit Polyclonal Anti-MBIP Antibody

Product Images

WB Suggested Anti-MBIP Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Bladder

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the C-terminal region of Human MBIP. Synthetic peptide located within the following region: FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: MAP3K12 binding inhibitory protein 1
• Database Link:
  NP_057670
  Entrez Gene 51562 Human
  UniProt ID Q9NS73
• Background: MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
• Synonyms: MAP3K12 binding inhibitory protein 1; MUK-binding inhibitory protein; OTTHUMP00000178844
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 86%; Mouse: 86%; Rabbit: 86%