Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-MED21 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MED21. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MED21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED21 Antibody: synthetic peptide directed towards the middle region of human MED21. Synthetic peptide located within the following region: DSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALA |
MED21 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MED21 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human MED21 (NP_004255.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MED21