Surb7 (MED21) Rabbit Polyclonal Antibody

CAT#: TA332096

Rabbit Polyclonal Anti-MED21 Antibody

Product Images

WB Suggested Anti-MED21 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MED21 Antibody: synthetic peptide directed towards the middle region of human MED21. Synthetic peptide located within the following region: DSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: mediator complex subunit 21
• Database Link:
  NP_004255
  Entrez Gene 9412 Human
  UniProt ID Q13503
• Background: MED21 belongs to the Mediator complex subunit 21 family. It is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
• Synonyms: hSrb7; SRB7; SURB7
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors