Rabbit Polyclonal Anti-METTL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL3 antibody: synthetic peptide directed towards the N terminal of human METTL3. Synthetic peptide located within the following region: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS |
Rabbit Polyclonal Anti-METTL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL3 antibody: synthetic peptide directed towards the middle region of human METTL3. Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD |
Rabbit Polyclonal Anti-METTL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL3 antibody: synthetic peptide directed towards the middle region of human METTL3. Synthetic peptide located within the following region: AKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELLNTTTA |
Rabbit Polyclonal Anti-METTL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL3 antibody: synthetic peptide directed towards the C terminal of human METTL3. Synthetic peptide located within the following region: KIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKN |
METTL3 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human METTL3 (NP_062826.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
