Rabbit Polyclonal Anti-MFRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFRP antibody: synthetic peptide directed towards the middle region of human MFRP. Synthetic peptide located within the following region: HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS |
Rabbit Polyclonal Anti-MFRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFRP antibody: synthetic peptide directed towards the N terminal of human MFRP. Synthetic peptide located within the following region: TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE |
Germany
Japan
United Kingdom
China