USD 450.00
2 Weeks
Ovary specific acidic protein (MGARP) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 175-204 amino acids from the C-terminal region of human C4orf49 |
Rabbit Polyclonal Anti-MGARP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MGARP antibody is: synthetic peptide directed towards the C-terminal region of Human MGARP. Synthetic peptide located within the following region: EAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEA |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) MGARP mouse monoclonal antibody,clone OTI3F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
MGARP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of mouse OSAP |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
MGARP mouse monoclonal antibody,clone OTI3F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MGARP mouse monoclonal antibody,clone OTI3F3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MGARP mouse monoclonal antibody,clone OTI3F3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
MGARP mouse monoclonal antibody,clone OTI3F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Germany
Japan
United Kingdom
China
