Ovary specific acidic protein (MGARP) Rabbit Polyclonal Antibody

CAT#: TA339618

Rabbit Polyclonal Anti-MGARP Antibody

Product Images

Host: Rabbit; Target Name: MGARP; Sample Tissue: Uterus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MGARP antibody is: synthetic peptide directed towards the C-terminal region of Human MGARP. Synthetic peptide located within the following region: EAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: mitochondria localized glutamic acid rich protein
• Database Link:
  NP_116012
  Entrez Gene 84709 Human
  UniProt ID Q8TDB4
• Background: MGARP plays a role in the trafficking of mitochondria along microtubules. It regulates the kinesin-mediated axonal transport of mitochondria to nerve terminals along microtubules during hypoxia. It participates in the translocation of TRAK2/GRIF1 from the cytoplasm to the mitochondrion. It also plays a role in steroidogenesis through maintenance of mitochondrial abundance and morphology.
• Synonyms: C4orf49; CESP-1; HUMMR; OSAP
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane