Rabbit Polyclonal Anti-MIER1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MIER1 Antibody: synthetic peptide directed towards the middle region of human MIER1. Synthetic peptide located within the following region: RRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRF |
MIER1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MIER1 |
MIER1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MIER1. |
Germany
Japan
United Kingdom
China
