Goat Polyclonal Anti-POLDIP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POLDIP2 Antibody: Peptide with sequence KTHTYYQVLIDARDC, from the internal region of the protein sequence according to NP_056399.1. |
MKRN1 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_038474.1; NP_001138597.1. |
Rabbit Polyclonal Anti-MKRN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKRN1 antibody: synthetic peptide directed towards the C terminal of human MKRN1. Synthetic peptide located within the following region: RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW |
Carrier-free (BSA/glycerol-free) MKRN1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MKRN1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MKRN1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MKRN1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
MKRN1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
MKRN1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MKRN1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MKRN1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
MKRN1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
MKRN1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
